PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000130123
Common NameNAC22
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 255aa    MW: 28863.7 Da    PI: 9.2096
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000130123genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.95.7e-51141381128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lppGfrFhPtdeelv +yL++kv + +l++ ++i+evd++k++PwdLp       +e yfFs+r+ ky++g+r+nrat+sgyWkatg dk++++  
  MDP0000130123  14 LPPGFRFHPTDEELVLQYLRRKVYSCPLPA-SIIPEVDVCKADPWDLPGD---CAQERYFFSTREAKYPNGNRSNRATSSGYWKATGLDKQIVTCr 105
                    79****************************.89***************44...35799*********************************98765 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    +g++vg+kktLvfy+g+ p+g++tdW+mheyr+
  MDP0000130123 106 GGQVVGMKKTLVFYRGKPPHGTRTDWIMHEYRF 138
                    8999***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.54E-6110173IPR003441NAC domain
PROSITE profilePS5100557.78414173IPR003441NAC domain
PfamPF023657.1E-2715137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MERINFVKNG VLRLPPGFRF HPTDEELVLQ YLRRKVYSCP LPASIIPEVD VCKADPWDLP  60
GDCAQERYFF STREAKYPNG NRSNRATSSG YWKATGLDKQ IVTCRGGQVV GMKKTLVFYR  120
GKPPHGTRTD WIMHEYRFVL PENPASIAPP EKNATQSPVV PMDDWVLCRI FFKKRGGKNE  180
EQQVQQPSCD VRKPKNSRPV FYDFMTKDRA NLSLAPCSSS SGSSGITDVV SSEQVDNDHE  240
ESSSSNSLGL IRRKQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-521217415166NAC domain-containing protein 19
4dul_A6e-521217415166NAC domain-containing protein 19
1ut7_B6e-521217415166NO APICAL MERISTEM PROTEIN
1ut7_A6e-521217415166NO APICAL MERISTEM PROTEIN
1ut4_B6e-521217415166NO APICAL MERISTEM PROTEIN
1ut4_A6e-521217415166NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.39630.0bud| fruit| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001281000.10.0NAC transcription factor 25-like
SwissprotQ9FY931e-96NAC83_ARATH; NAC domain-containing protein 83
TrEMBLD9ZJA00.0D9ZJA0_MALDO; NAC domain class transcription factor
STRINGPOPTR_0001s13380.11e-127(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.13e-95NAC domain containing protein 83